DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:491 Identity:174/491 - (35%)
Similarity:226/491 - (46%) Gaps:178/491 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ADVSH------LTNTYLPPKSAAASTSY---------ESYQAAPVEAAASETYVAPAAAASTYES 66
            :||||      :...|  |.....:.||         ..|.:.|..|..| ||.||..|  ||. 
  Fly   308 SDVSHQYISKPIVAAY--PAITKVAASYGGTASGALSHQYVSQPAIAKVS-TYAAPTVA--TYS- 366

  Fly    67 ESYSAPAASFTSESYAAPAAVEAAVETAAEETNEQPAASYVAPVVTK-TTYSAPAVSSYS----- 125
               |.||.|..|.||.|..:  .||   :.:...:||.:..||.|.| .||:|||:||||     
  Fly   367 ---SGPAISKLSTSYGASGS--GAV---SHQYVSKPAVAIAAPAVAKVATYAAPAISSYSTGPAI 423

  Fly   126 ----SYSAPAVVAKTYT---------------------------APAVVK--TYSAPAVSTYSAP 157
                ||:||.|  .||:                           |||:.|  ||:|||:|||:|.
  Fly   424 SKVASYAAPTV--STYSSGYGYGSSGSGAVSHQYVSKPAVAISAAPAIAKVATYAAPAISTYAAA 486

  Fly   158 AV------------SGYS------QTYTAPAVVK--TYSAPAVSTYT-APVVTKTYT-------- 193
            .|            ||||      |..:.|||.|  ||:|||:|||: ||.|||..|        
  Fly   487 PVVTKVATGYGGSGSGYSSGAVSHQYVSKPAVAKVATYAAPAISTYSAAPAVTKIATSYGGSGHG 551

  Fly   194 ----------------APVVAK--TYTAPAVSTY-TAPVVAK--TYTAPAVVKTYSAPAVS--TY 235
                            ||.:||  ||.:||:||| |||||:|  ||.||::....||||::  :|
  Fly   552 AVSHQYVSKPAVAISAAPAIAKVATYASPAISTYATAPVVSKVATYAAPSIATYSSAPALAKVSY 616

  Fly   236 S---------------------APAVSTY-TAPVVTKTYT------APVVTKTYTA-PAVVK--T 269
            |                     ||||:|| :||.:||..|      :..|:..|.: |||.|  .
  Fly   617 SQAADVSHQYISKPIVAAYPAAAPAVATYSSAPAITKLSTSYESSGSGAVSHQYVSKPAVAKVAA 681

  Fly   270 YSAPAVSTY-TAPAVSTY-TAPVVAKT----------YSA----------PAVSTYTAPVVTK-- 310
            |:|||:||| |||||||| :||||||.          ||:          |||:..:||.:.|  
  Fly   682 YAAPAISTYATAPAVSTYSSAPVVAKVATGYGGSGSGYSSGAVSHQYISKPAVAIASAPAIAKVA 746

  Fly   311 TYSAPAVSSY-SAPAVVSSYSGSSGTVYGSNGGYVY 345
            ||:|||:|:| |||::....:|...:.:|....:.|
  Fly   747 TYAAPAISAYSSAPSLTKIATGYGESAHGGALSHQY 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 77/225 (34%)
rne <109..299 CDD:236766 123/333 (37%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.