DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and CG11350

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_647910.1 Gene:CG11350 / 38554 FlyBaseID:FBgn0035552 Length:456 Species:Drosophila melanogaster


Alignment Length:471 Identity:181/471 - (38%)
Similarity:220/471 - (46%) Gaps:154/471 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFAILSLALLAVASADVSHL-TNTYLPPKSAAASTSYESYQA-----------------APVE 47
            ||||  |..|.:|..:|||||| ::.||||...|||....||.|                 ||||
  Fly     1 MKFF--LFCAFIAAVAADVSHLPSSQYLPPGRGAASAPVASYSAPSQSYSVEASAPVASYSAPVE 63

  Fly    48 A----AASETYVAPAAAASTY--ESESYSAPAASFTSE------SYAAPA---AVEAAVETAAEE 97
            :    |||...|:.||.|.:|  .::|||||||::|:.      ||||||   :..||..|||..
  Fly    64 SSYSVAASAPAVSYAAPAVSYAAPAQSYSAPAATYTAAASAPAVSYAAPAQSYSAPAATYTAAAS 128

  Fly    98 TNEQPAASYVAPVVTKTTYSAPAVSSYSSYSAPAVVAKTYTAPAVVKTY----SAPAVSTYSAPA 158
            .   ||.||.||.   .:|||||.:..::.|||||   ||.|||  :||    |||||| |||||
  Fly   129 A---PAVSYAAPA---QSYSAPAATYTAAASAPAV---TYAAPA--QTYTAAASAPAVS-YSAPA 181

  Fly   159 VS----------------GY------------------SQTYTAP------AVVKTYSAPAVSTY 183
            .|                ||                  |..|..|      |....|..||.|. 
  Fly   182 ESYETAASEPAHTFSANDGYRYKTHKRVVLRRHRRGVPSNDYLPPFQGAASAPTSEYLPPAASA- 245

  Fly   184 TAPVVTKTYTAPVV-----AKTYTAPAVSTYTAPVVAKTY----TAPA----------------V 223
            .|||.....:||.|     |:||:||||| |..|  |::|    :|||                |
  Fly   246 PAPVYQSAASAPAVSYAAPAQTYSAPAVS-YAEP--AESYETAASAPAHSFSSNDGYRYKTHKRV 307

  Fly   224 V-------------KTYSAPAVS----TYSAPAVSTYTAPVVTKTYTAPVVTKTYTAPAVVKTYS 271
            |             ..|..||.|    .|||||.| |:||..|.|..|.....:|.|||  ::||
  Fly   308 VLRRHRRDVSHLPSNDYLPPAASAPAPVYSAPAQS-YSAPAATYTAAASAPAVSYAAPA--QSYS 369

  Fly   272 APAVSTYT----APAVSTYTAPVVAKTYSAPAVSTYTAPVVTKTYSAPAVSSYSAPAVVSSYSGS 332
            ||| :|||    ||||| |:||  :::||||...:..|.....:||||| :||||||  .||..:
  Fly   370 APA-ATYTAAASAPAVS-YSAP--SQSYSAPEYYSGAASAPAVSYSAPA-ASYSAPA--ESYETA 427

  Fly   333 SGT---VYGSNGGYVY 345
            :..   .:.||.||.|
  Fly   428 ASEPAHSFSSNDGYRY 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 83/232 (36%)
rne <109..299 CDD:236766 102/279 (37%)
CG11350NP_647910.1 GYR 198..215 CDD:128953 2/16 (13%)
GYR 296..313 CDD:128953 2/16 (13%)
GYR 438..455 CDD:128953 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468778
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.