DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and CG34205

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001097407.1 Gene:CG34205 / 37526 FlyBaseID:FBgn0085234 Length:217 Species:Drosophila melanogaster


Alignment Length:287 Identity:104/287 - (36%)
Similarity:151/287 - (52%) Gaps:77/287 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 STYESESYSAPAASFTSESYAAPAAVEAAVETAAEETNEQPAASYVAPVVTKTTYSAPAVSSYS- 125
            |||...|.|.|:.|.:|      |:::..:.|:.      .|.:..||.:....:|||   .|| 
  Fly     4 STYSCNSPSKPSDSLSS------ASMKLLILTSL------LAVATAAPGLLDYGHSAP---DYSY 53

  Fly   126 SYSAPAVVAKTYTAPAVVKTYSAPAVSTYSAPAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTK 190
            :::|||:   ||.|       :||.:.:|:|||:              ||:||      |||: |
  Fly    54 AHAAPAI---TYAA-------AAPVIKSYAAPAI--------------TYAAP------APVI-K 87

  Fly   191 TYTAPVVAKTYTAPAVSTYTAPVVAKTYTAPAVVKTYSAPAVSTYSAPAVSTYTAPVVTKTYTAP 255
            :|.||.::..:.|||:| |.||.|.|:|.||..||. :|||.|.....:|.::..|:| |:|.||
  Fly    88 SYAAPAISYAHAAPAIS-YAAPTVVKSYAAPVAVKV-AAPATSYSHFSSVVSHATPIV-KSYAAP 149

  Fly   256 VVTKTYTAPA-VVKTYSAPAVS-TYTAPAVSTYTAPVVAKTYSAPAVSTYTAPVVTKTYSAPAVS 318
            .:  .|.||| |:|:|:|||:| .:.|||:| |.||.|.|:|:|||:| |.||.:.|:|:|||:|
  Fly   150 AI--AYAAPAPVIKSYAAPAISYAHAAPAIS-YAAPTVVKSYAAPAIS-YAAPALVKSYAAPALS 210

  Fly   319 SYSAPAVVSSYSGSSGTVYGSNGGYVY 345
            .                     |||.|
  Fly   211 L---------------------GGYGY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 34/124 (27%)
rne <109..299 CDD:236766 76/192 (40%)
CG34205NP_001097407.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.