DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and CG10953

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001261042.1 Gene:CG10953 / 36941 FlyBaseID:FBgn0034204 Length:278 Species:Drosophila melanogaster


Alignment Length:361 Identity:111/361 - (30%)
Similarity:125/361 - (34%) Gaps:111/361 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFAILSLALLAVASADVSHLTNTYLPPKSAAASTSYESYQAAPVEAAASETYVAPAAAASTYE 65
            |||. :::.|:||.|..|||||...|.||..|..      ||.||               |..|:
  Fly     1 MKFL-VVAFAVLACAYGDVSHLGYDYSPPAPAPV------YQPAP---------------APVYQ 43

  Fly    66 SESYSAPAASFTSESYAAPAAVEAAVETAAEETNEQPAASYVAPVVTKTTYSAPAVSSYSSYSAP 130
                            .|||.|            .|||.   ||||......||.|     ..||
  Fly    44 ----------------PAPAPV------------YQPAP---APVVIPAPAPAPVV-----IPAP 72

  Fly   131 AVVAKTYTAPAVVKTYSAPAVSTYSAPAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTKTYTAP 195
            |.......|||.||||..||..:..||...      .|||.:: ..||......||:        
  Fly    73 APAPVVIPAPAPVKTYVPPAPISIPAPVYQ------PAPAPIR-IPAPVYQPAPAPI-------- 122

  Fly   196 VVAKTYTAPAVSTYTAPVVAKTYTAPAVVKTYSAPAVSTYSAPAVSTYTAPVVTKTY---TAPVV 257
                :..|||.....||....||..||     .|||.....|||....:.|.....|   .||||
  Fly   123 ----SIPAPAPIEIPAPAPVNTYIPPA-----PAPAPVYQPAPAPIPVSIPAPAPVYQPAPAPVV 178

  Fly   258 TKTYTAPAVVKTYSAPAVSTYTAPAVSTYTAPVVAKTYSAPAVSTYTAPVVTKTYSAPAVSSYSA 322
               ..|||     .||.|....|||.....||...|:|..||..:..||  ...|. ||..|..|
  Fly   179 ---IPAPA-----PAPVVIPAPAPAPVVIPAPAPVKSYVPPAPISIPAP--APVYQ-PAPISIPA 232

  Fly   323 PAVVSSYSGSSGTVY-------------GSNGGYVY 345
            ||.|  |..:...||             .||.||.|
  Fly   233 PAPV--YQPAPAPVYQPTNTQVLEEIEPASNDGYRY 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 41/156 (26%)
rne <109..299 CDD:236766 61/192 (32%)
CG10953NP_001261042.1 FLO_LFY 23..>60 CDD:279962 21/88 (24%)
GYR 261..278 CDD:128953 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.