DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and CG32564

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_728056.1 Gene:CG32564 / 326222 FlyBaseID:FBgn0052564 Length:409 Species:Drosophila melanogaster


Alignment Length:405 Identity:148/405 - (36%)
Similarity:181/405 - (44%) Gaps:102/405 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFAILSLALLAVASADVSHLTNTYLPPK---------------------------------SA 32
            ||.:..:||||||: ||.|.  ::..|..|                                 |.
  Fly     1 MKLYVCVSLALLAL-SAPVP--SDALLGAKLALLKAIGGGLGGGSSGGGGYSTGSGGYGGGYGSG 62

  Fly    33 AASTSY-ESYQAAPVEAAASETYVAPAAAASTYESESYSAPAASFTSESYAAPAAVEAAVETAAE 96
            ..|..| :.|...|.....:..| ..::::|...|.||...........|.....|...::..  
  Fly    63 GYSGGYNQGYYNQPSRPVYNSEY-GSSSSSSASSSSSYGGSYGGGYGGGYGGGEQVIKVIKVV-- 124

  Fly    97 ETNEQPAASYVAPVVTKTTY-----SAPAVSSYSSYSAPAVVAKTYTAPAVVKTYSAPAVSTYSA 156
               |||:.||.........|     ||.:.:|.:|||||:|   :|:|||...|||||      |
  Fly   125 ---EQPSYSYGRSSGYGGNYGGYSSSASSSASANSYSAPSV---SYSAPAPAVTYSAP------A 177

  Fly   157 PAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTKTYTAPVVAKTYTAPAVSTYTAPVVAKTYTAP 221
            ||||     |:|||...||||||    .||.||.:..|||| :...|||| ||:||       ||
  Fly   178 PAVS-----YSAPAPAVTYSAPA----PAPAVTYSAPAPVV-RVQAAPAV-TYSAP-------AP 224

  Fly   222 AVVKTYSAPAVS---TYSAPA----VSTYTAPVVTKTYTAPVVTKTYTAPAVVKTYSAPAVS-TY 278
            |...||||||.:   ||||||    |....||.|  ||:||....||:|||...|||.||.: ||
  Fly   225 APAVTYSAPAPAPAVTYSAPAPAPVVRVQAAPAV--TYSAPAPAVTYSAPAPAVTYSGPAPAVTY 287

  Fly   279 TAPA---VSTYTAPVVAKTYSAPAVSTYTAP-----VVTKTYS-------APAVSSYSAPAVVSS 328
            :|||   |..|:||..|....|||..:| ||     .|.||..       ||| ..|..|||.||
  Fly   288 SAPAPVPVVRYSAPAPAPISYAPAPVSY-APQPQSQQVVKTIKLIVDEDRAPA-QVYGPPAVESS 350

  Fly   329 YSGSSGTVYGSNGGY 343
            ||.:|.:...|.|||
  Fly   351 YSSASSSAAASAGGY 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 52/195 (27%)
rne <109..299 CDD:236766 94/205 (46%)
CG32564NP_728056.1 PRK12323 <165..>319 CDD:237057 88/180 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.