DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and CG11584

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster


Alignment Length:433 Identity:159/433 - (36%)
Similarity:205/433 - (47%) Gaps:140/433 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NTYLP-------------------PKSAAASTSYESYQAAPVEAAA----------------SET 53
            |.|||                   |:....:|:|.:..||||.|.|                .:|
  Fly   139 NAYLPPAPVQQFVPAPEPVVANIAPQQETITTTYNAPAAAPVPAPAPIAIPVPAVQEQHQVIQQT 203

  Fly    54 YVAPAAAASTYESESYSAPA-ASFTSESYAAPA-AVEAAVETAAE--ETNEQPAASYVAPVVTKT 114
            |..||.|.:.  .:|||||| |....::|:||| .|:....|||.  :..:|...|..|||..:.
  Fly   204 YSVPAPAPAV--QQSYSAPAPAPVVQQTYSAPAPVVQEQTYTAAAPVQAVQQLTYSAPAPVTQEQ 266

  Fly   115 TYSAPA--VSSYSSYSAPA---VVAKTYT--APAVVKTYSAPAVS-----TYSAPAVSGYSQTYT 167
            .|||||  |...||..|||   |..:.|:  |||:.:||||||.:     ||||||.:. .|||:
  Fly   267 YYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQTYSAPAPAPVVQQTYSAPAPAP-QQTYS 330

  Fly   168 APA--------VVKTYSAPAVS-------TYTAPVVTK-------TYTAPVVAKTYTAPAVSTYT 210
            |||        ||::|||||.:       :|.||||.:       ...||||.::|:|||    .
  Fly   331 APAPAVQEQTQVVQSYSAPAPAPVAQQTYSYPAPVVQQAPVVQAVAQQAPVVQQSYSAPA----P 391

  Fly   211 APVVAKTYTAPAVV---------KTYSAPAV-STYSAPAVSTYTAPVVTKTYT--APVVTKT--- 260
            ||||.:||:|||.|         ....||.| .:|||||    .||||.::|:  ||||.:|   
  Fly   392 APVVQQTYSAPAPVVQETIQQAPVIQQAPVVQQSYSAPA----PAPVVQQSYSAPAPVVQETIQQ 452

  Fly   261 ----YTAPAVVKTYSAPA----VSTYTAPAVSTYTAPVVAKTYSAPAVSTYTAPVVTKTYSAPAV 317
                ..||.|.::|||||    .:...||.:.  .||||.::|||||    .||||.::|||||.
  Fly   453 APVIQQAPVVQQSYSAPAPVVQETIQQAPVIQ--QAPVVQQSYSAPA----PAPVVQQSYSAPAP 511

  Fly   318 S---------------SYSAPAVVS------------SYSGSS 333
            :               ||:|||.||            .|||.|
  Fly   512 APVVQESIQQAPVIQQSYTAPAPVSIPEPVQQIVQQPQYSGYS 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 76/203 (37%)
rne <109..299 CDD:236766 101/246 (41%)
CG11584NP_572941.1 rne <209..408 CDD:236766 85/205 (41%)
rne <329..539 CDD:236766 87/223 (39%)
TFIIA 475..>635 CDD:281188 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.