DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and CG2962

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_572612.2 Gene:CG2962 / 31952 FlyBaseID:FBgn0030186 Length:376 Species:Drosophila melanogaster


Alignment Length:304 Identity:99/304 - (32%)
Similarity:121/304 - (39%) Gaps:82/304 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLPPKSAAASTSYESYQAAPVEAAASETYVAPAAAASTYESESY--------SAPAA--SFTSES 80
            ||||...|.|       :..|.....|:  ||..:|...||...        |.|.|  ||...|
  Fly   117 YLPPAGPAPS-------SVKVIKILQES--APIVSAPLVESAPQIVKVVNVASGPVAGPSFIGGS 172

  Fly    81 YAAPAAVEAAVETAAEETNEQPAASYVAPVVTKTTYSAPAVSS--YSSYSAPAVVAKTYTAPAVV 143
            .....||...::...|..:..         ::...||:...||  |||..|..||       .|:
  Fly   173 SVGGGAVSQVIKVVHESHDSG---------ISSGGYSSGGYSSGGYSSGGATKVV-------RVI 221

  Fly   144 KTYSAPAVSTYSAPAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTKTYTAPVVAKTYTAPAVST 208
            ..:||||.....||        ...||.|   :|| |::|..|            :...||| ..
  Fly   222 HEHSAPAAGPAYAP--------IDVPAPV---AAP-VASYLPP------------QEIAAPA-PV 261

  Fly   209 YTAPVVAKTYTAPAVVKTYSAPA-VSTYSAPAVSTYTAPVVTKTYTAPVVTKTYTAPAVVKTYSA 272
            |.||..|..|.|||....||||| ...|||||    .|||    |:||.....|:|||....|||
  Fly   262 YAAPAPAPVYAAPAPAPVYSAPAPAPVYSAPA----PAPV----YSAPAPAPVYSAPAPAPAYSA 318

  Fly   273 PAVSTYTAPAVSTYTAPVVAKTYSAPAVSTYTAPVVTKTYSAPA 316
            |      ||| ..|:||..|..|:|||    .|||::..:.|||
  Fly   319 P------APA-PVYSAPAPAPVYAAPA----PAPVLSVPHPAPA 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 43/168 (26%)
rne <109..299 CDD:236766 69/192 (36%)
CG2962NP_572612.2 DUF4766 57..189 CDD:292595 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.