DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and CG31626

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_724320.1 Gene:CG31626 / 318859 FlyBaseID:FBgn0051626 Length:285 Species:Drosophila melanogaster


Alignment Length:362 Identity:130/362 - (35%)
Similarity:149/362 - (41%) Gaps:103/362 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFAILSLALLAVASADVSHLTNTYLPPKSAAASTSYESYQAAPVEAAASETYVAPAAAASTYE 65
            ||.| :.::..:|:||||||||.                                    ..|.| 
  Fly     1 MKLF-VFAVCAIALASADVSHLN------------------------------------LGSGY- 27

  Fly    66 SESYSAPAASFTSESYAAPAAVEAAVETAAEETNEQPAASYVAPVVTKTTYSAPAVSSYSSYSAP 130
              ||:.|..:|...|..|||                    |:.||  :...||||.:..  ||||
  Fly    28 --SYNKPTPTFNIPSAPAPA--------------------YLPPV--QEVISAPAPAPV--YSAP 66

  Fly   131 AVVAKTYTAPAVVKTYSAPA---VSTYSAPAVSGYSQTYTAPAVVKTYSAPA-VSTYTAPVVTKT 191
            | .|..|:|||....|||||   ||.|..|.     |...|||.|  ||||| ...|:||.....
  Fly    67 A-PAPVYSAPAPAPVYSAPAPAPVSEYLPPV-----QDIPAPAPV--YSAPAPAPVYSAPAPAPV 123

  Fly   192 YTAPVVAKTYTAPAVSTYTAPVVAKTYTAPAVVKTYSAPA-VSTYSAPA---VSTYTAPV----- 247
            |:||..|..| .|.|....||..|..|:|||....||||| ...|||||   ||.|..||     
  Fly   124 YSAPAPAPEY-LPPVQDIPAPAPAPVYSAPAPAPVYSAPAPAPVYSAPAPAPVSEYLPPVQDIPA 187

  Fly   248 VTKTYTAPVVTKTYTAPAVVKTYSAPAVSTYTAPAVSTYTAPVVAKTYSAPA---VSTYTAPVVT 309
            ....|:||.....|:|||....|||||.:....|.|....||..|..|||||   ...|:||...
  Fly   188 PAPVYSAPAPAPVYSAPAPAPVYSAPAPAPEYLPPVQDLPAPAPAPVYSAPAPAPAPVYSAPAPA 252

  Fly   310 KTYSAPAVSS-YSAPAVVSSYSGSSGTVYGSNGGYVY 345
            ..|||||.:. |||||.|.|             ||.|
  Fly   253 PVYSAPAPAPVYSAPAPVES-------------GYQY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 47/160 (29%)
rne <109..299 CDD:236766 87/202 (43%)
CG31626NP_724320.1 PRK12323 <45..>222 CDD:237057 81/209 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468777
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR15363
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.