DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and abu-10

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_508659.1 Gene:abu-10 / 185248 WormBaseID:WBGene00000033 Length:375 Species:Caenorhabditis elegans


Alignment Length:124 Identity:29/124 - (23%)
Similarity:41/124 - (33%) Gaps:49/124 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAILSLALLAVASADVSHLTNTYLPPKSAAASTSYESYQA---APVEAAAS-------------- 51
            |||::|||                     :|.|..|..||   |||:...|              
 Worm     9 FAIVALAL---------------------SAPTLREKRQACSCAPVQQQPSCCQQSTINVQVQYT 52

  Fly    52 ETYVAPAAAASTYESESYSAPAASFTSESYAAPAAVEAAVETAAEETNEQPAASYVAPV 110
            :...|||......:.:. ..||.:      .||...:..   |.:...:|||.: .|||
 Worm    53 QVQQAPAQDPCACQPQQ-QQPACN------CAPVQQDPC---ACQPQQQQPACN-CAPV 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 23/99 (23%)
rne <109..299 CDD:236766 2/2 (100%)
abu-10NP_508659.1 PRK03427 <119..>239 CDD:235124
PRK03427 <204..>306 CDD:235124
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.