DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and pou2af1

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_009289855.1 Gene:pou2af1 / 103908823 -ID:- Length:248 Species:Danio rerio


Alignment Length:255 Identity:59/255 - (23%)
Similarity:87/255 - (34%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TSESYAAPAAVEAAVETAAEETNEQPAASYVAPVVTKTTYSAPAVSSYSSYSAPAVVAKTYTAPA 141
            ||:.|.. ..|:..|:..........|.|....:|...|..:..::..|::   |.|.::....:
Zfish    10 TSKPYQG-VRVKDPVKELLRRKRGNAARSTATVMVPSNTLQSCTLAGTSTF---AEVPQSGLNDS 70

  Fly   142 VVKTYSAPAVSTYSAPAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTKTYTA-PVVAKTYTAPA 205
            ||.              |||....:.|.....|...| :|.:|.|.......| |..|..|..|.
Zfish    71 VVD--------------VSGLCTGWIAQTTSTTALQP-LSHWTPPDCQHHDPAIPSHADMYVQPI 120

  Fly   206 VSTYTAPVVAKTYTAPAVVKTYSAPAVSTYSAPAVSTYTAPVVTKTYTAPVVTKTYTAPAVVKTY 270
            ...||  ||.                    |:|.::...||:.|...|..      |:.:|:...
Zfish   121 CPGYT--VVG--------------------SSPMLTFAHAPLFTNLATVS------TSSSVLPQV 157

  Fly   271 SAPAVS-TYT--APAVSTYTAPVV--AKTYSAPAV--STYTAPVVTKTYSAPAVSSYSAP 323
            ..|..| ||.  |..:||...||:  :...|||.:  ...|.||::.....|.|....||
Zfish   158 EVPDSSLTYIPWAQPLSTIPGPVMQASSALSAPQLFPVPLTLPVLSPEPEPPQVEPQQAP 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 22/108 (20%)
rne <109..299 CDD:236766 44/195 (23%)
pou2af1XP_009289855.1 PD-C2-AF1 9..246 CDD:312716 59/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15363
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.