DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32603 and zgc:174862

DIOPT Version :9

Sequence 1:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001116094.1 Gene:zgc:174862 / 100142646 ZFINID:ZDB-GENE-080303-29 Length:294 Species:Danio rerio


Alignment Length:302 Identity:78/302 - (25%)
Similarity:139/302 - (46%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VSHLTNTYLPPKSAAASTSYESYQAAPVEAAASETYVAPAAAASTYESESYSAPAASFTSESYAA 83
            :|....:.|.|:::.:|.|.::    ...|...:||   .:|.|..||.|...|..|.::.|   
Zfish    26 ISRCITSALTPQTSTSSLSAQT----STSALTPQTY---TSALSPQESTSALTPQTSTSALS--- 80

  Fly    84 PAAVEAAVETAAEETNEQPAASYVAPVVTKTTYSAPAVSSYSSYSAPAVVAKTYTAPAVVKTYSA 148
                   .:|:....|.|.:.|.:: ..|.|:...|.:|: |:.||       .|:.:|:.    
Zfish    81 -------AQTSTSVLNPQTSTSALS-AQTSTSVLNPQMST-SALSA-------QTSTSVLN---- 125

  Fly   149 PAVSTYSAPAVSGYSQTYTAPAVVKTYSAPAVSTYTAPVVTKTYTAPVVAKTYTA---PAVSTYT 210
            |.:||   .|:|..:.|......:.| ||.:..|.|:.:..:|.|:.:.|:|.|:   |.:|  |
Zfish   126 PQMST---SALSAQTSTSVLNPQMST-SALSAQTSTSVLNPQTSTSALSAQTSTSVLNPQMS--T 184

  Fly   211 APVVAKTYTAPAVVKTYSAPAVSTYSAPAVSTYTAPVVTKTYTAPVVTKTYTAPAVVKTYSAPAV 275
            :.:.|:|.|  :|:.    |.:|| ||.:..|.|:.:..:|.|:.:..:|.|:....:| |..|:
Zfish   185 SALSAQTST--SVLN----PQMST-SALSAQTSTSVLNPQTSTSALSAQTSTSVLNPQT-STSAL 241

  Fly   276 STYTAPAV---STYTAPVVAKTYSA---PAVSTYTAPVVTKT 311
            |..|:.:|   .|.|:.:.|:|.::   |.:||......|.|
Zfish   242 SAQTSTSVLNPQTSTSALSAQTSTSVLNPQMSTSALSAQTST 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 38/156 (24%)
rne <109..299 CDD:236766 53/198 (27%)
zgc:174862NP_001116094.1 TFIIA 90..>255 CDD:281188 51/191 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5208
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.