DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hog and AT5G38840

DIOPT Version :10

Sequence 1:NP_727787.1 Gene:hog / 318105 FlyBaseID:FBgn0266710 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_198700.2 Gene:AT5G38840 / 833875 AraportID:AT5G38840 Length:735 Species:Arabidopsis thaliana


Alignment Length:75 Identity:26/75 - (34%)
Similarity:45/75 - (60%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GIHLLGKSGACNVVLTYDNMSDIHAVV-VVRNGRIFIKDLESIHGIYLNFKEHRLGSE-FYEIFV 81
            |.:|.|:.|.|:..|.:.::|..|||: ..|:|..:|.||.|.||..:|  ::::..: |.::.|
plant   123 GAYLFGRDGICDFALEHPSISRFHAVIQYKRSGAAYIFDLGSTHGTTVN--KNKVDKKVFVDLNV 185

  Fly    82 GDDVAFGVAT 91
            ||.:.||.:|
plant   186 GDVIRFGGST 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hogNP_727787.1 FHA 10..92 CDD:438714 26/75 (35%)
AT5G38840NP_198700.2 FHA_Kanadaptin 103..202 CDD:438729 26/75 (35%)
PTZ00108 <280..602 CDD:240271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.