DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32591 and enkd1

DIOPT Version :9

Sequence 1:NP_001285256.1 Gene:CG32591 / 318104 FlyBaseID:FBgn0052591 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001119880.1 Gene:enkd1 / 563309 ZFINID:ZDB-GENE-081104-180 Length:352 Species:Danio rerio


Alignment Length:407 Identity:93/407 - (22%)
Similarity:154/407 - (37%) Gaps:101/407 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RRSHGGGRDFLQENKQNVSRMETNGRCIAAANARRVPLWRPVVLHYPEKLRPHVYNIQRRTRPLH 69
            |.|...||  |:.|..|.|.....|           ||.....||      |..|:.:...||..
Zfish    25 RPSSARGR--LEGNAPNGSSPLLKG-----------PLAPDPALH------PGCYSARSSPRPRI 70

  Fly    70 GAHESPRLRSGLAQPYGFHNEMRR---RMPPNPCGCDLTTR---KTVERKEQERLQGGWEDQQVP 128
            ||:.:..|..|.....|  |.:|.   .:.|:|.......|   |...||.:| :|..:.:.:..
Zfish    71 GANAAHILERGQRGVVG--NLLRLDGVALSPSPAKPKPAIRDFGKENVRKLRE-VQRRFRELEAQ 132

  Fly   129 RKCCSGCTCHHGYPTN------KPSDQDHQAKEVSQHQGHHGQAVAPHQGQQSETDGQIQPKHGE 187
            |:        |..|..      .|..||..::.::|.|               ||....:|::..
Zfish   133 RE--------HAKPVPVKALWISPKYQDVPSRVMAQLQ---------------ETSPLKKPEYQN 174

  Fly   188 GDQADRISVCSRMSQESRASRASRASRASRASRRSEAQSTQGQGNNDPEAPLSARSSASTKTLKS 252
            ..:|.  |||              .:......|||::..| ..|::|.|  :..|.........:
Zfish   175 FLKAH--SVC--------------GAGGRPVLRRSDSGPT-AAGDSDSE--MHVRGHTVDFVSHN 220

  Fly   253 KRSVSQESVRSNATIKSNITVASRSTTASKRSQVSRKSKLMEVMPPPTHLEDRRP---KEREKEK 314
            .|:.::.|:|.:.::::         ...|....:.|.|:      |.:||.|:.   ||.|::|
Zfish   221 ARAAAKTSMRRSQSLQN---------LQDKTPACAVKGKV------PPYLEQRKAQWRKEEEEKK 270

  Fly   315 A----PTAIEGYTPLTPSERQAALQDAHVKYSKLVEEYNRMPVSEPTLRVRNRKIAIERQLDELD 375
            .    |:...|:|.::..|||..|......:..||.|...:||...||.:|:|:..::::|.|::
Zfish   271 RNTPDPSVPAGHTQMSERERQETLHSLKETHRSLVSELLSLPVKADTLSIRSRRADLDQRLSEVE 335

  Fly   376 YAINMFDQPHMDMYYKK 392
            .||.:|.:   |..|.|
Zfish   336 EAIKIFSR---DKVYVK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32591NP_001285256.1 Enkurin <308..381 CDD:290575 24/76 (32%)
enkd1NP_001119880.1 Enkurin 249..343 CDD:316387 30/99 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383928at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21490
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
33.070

Return to query results.
Submit another query.