powered by:
Protein Alignment CG32591 and CG16984
DIOPT Version :9
Sequence 1: | NP_001285256.1 |
Gene: | CG32591 / 318104 |
FlyBaseID: | FBgn0052591 |
Length: | 392 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647729.1 |
Gene: | CG16984 / 38322 |
FlyBaseID: | FBgn0062517 |
Length: | 307 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 13/71 - (18%) |
Similarity: | 33/71 - (46%) |
Gaps: | 0/71 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 312 KEKAPTAIEGYTPLTPSERQAALQDAHVKYSKLVEEYNRMPVSEPTLRVRNRKIAIERQLDELDY 376
:...|..:.|...:..:||...|:...:..:::.::|..|.:...::..|.||..:|..|.:::.
Fly 227 QSSGPPPMPGMRVMEQAERNEILEGLRLSLTEMTKQYQSMSLLIDSIAKRQRKSKLESDLRQVEQ 291
Fly 377 AINMFD 382
.|.:.:
Fly 292 DILLIE 297
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR21490 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.