DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32591 and CG16984

DIOPT Version :9

Sequence 1:NP_001285256.1 Gene:CG32591 / 318104 FlyBaseID:FBgn0052591 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_647729.1 Gene:CG16984 / 38322 FlyBaseID:FBgn0062517 Length:307 Species:Drosophila melanogaster


Alignment Length:71 Identity:13/71 - (18%)
Similarity:33/71 - (46%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 KEKAPTAIEGYTPLTPSERQAALQDAHVKYSKLVEEYNRMPVSEPTLRVRNRKIAIERQLDELDY 376
            :...|..:.|...:..:||...|:...:..:::.::|..|.:...::..|.||..:|..|.:::.
  Fly   227 QSSGPPPMPGMRVMEQAERNEILEGLRLSLTEMTKQYQSMSLLIDSIAKRQRKSKLESDLRQVEQ 291

  Fly   377 AINMFD 382
            .|.:.:
  Fly   292 DILLIE 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32591NP_001285256.1 Enkurin <308..381 CDD:290575 13/68 (19%)
CG16984NP_647729.1 Enkurin 184..297 CDD:290575 13/69 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21490
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.