DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32591 and Enkd1

DIOPT Version :9

Sequence 1:NP_001285256.1 Gene:CG32591 / 318104 FlyBaseID:FBgn0052591 Length:392 Species:Drosophila melanogaster
Sequence 2:NP_001099650.1 Gene:Enkd1 / 291975 RGDID:1307357 Length:346 Species:Rattus norvegicus


Alignment Length:364 Identity:75/364 - (20%)
Similarity:126/364 - (34%) Gaps:111/364 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 MPPNPCGCDLTTRKTVERKEQERLQG----------GWE-DQQVPRKCCSGCTCHHGYPTNKPSD 148
            :||:|..|....|:..  ..|.||:|          |.: |...||.           |..:|. 
  Rat    12 IPPDPTLCPDYYRRPA--SAQGRLEGNALKLDLLTSGRDLDSSPPRG-----------PRIRPG- 62

  Fly   149 QDHQAKEVSQHQGHHGQAVAPHQGQQSETDGQIQ----------------PKHGEGDQADRISVC 197
                |:|:.:            :||:...|..:|                ||..|.:...||...
  Rat    63 ----AREILE------------RGQRGVGDVLLQLGGISLGSGVSPKRKDPKDHEKENLRRIKEI 111

  Fly   198 SRMSQESRASR------------------------ASRASRASRASRRSEAQSTQGQGNNDPEAP 238
            .|..|:...||                        .:|......||....||..:......|..|
  Rat   112 QRRFQDQERSREQAQPKPLKALWRSPKYDSVESRVKARMKELGPASVTEPAQFLRAHSRCGPGLP 176

  Fly   239 LSARSSASTKTL---KSK-------------RSVSQESVRSNATIKSNITVASRSTTASKRSQVS 287
            .| |:|:...||   |:|             |:..:...|.:.:::....|..:...|.:....:
  Rat   177 PS-RASSPQLTLPGSKAKGPGLGVDFISHNARAAKRAPRRHSRSLQVLAQVLEQQRQAQEHYNAT 240

  Fly   288 RKSKLMEVMPPPTHLEDRRP---KEREKEKA----PTAIEGYTPLTPSERQAALQDAHVKYSKLV 345
            :|..:      |.:|.:||.   ||.|..|.    |:...|:|.:..::|...|.:.....|||:
  Rat   241 QKGHV------PHYLLERRDLWRKEAEARKRSQPDPSMPPGHTLMPENQRLETLNNLLQSQSKLL 299

  Fly   346 EEYNRMPVSEPTLRVRNRKIAIERQLDELDYAINMFDQP 384
            .|...:|....:||.:..:..::|:|.:::.||.:|.:|
  Rat   300 RELVLLPAGADSLRAQGYRAELDRKLVQIEEAIKIFSRP 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32591NP_001285256.1 Enkurin <308..381 CDD:290575 20/76 (26%)
Enkd1NP_001099650.1 Enkurin 243..337 CDD:290575 25/99 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1383928at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21490
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
33.070

Return to query results.
Submit another query.