DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA2B1 and SLIRP2

DIOPT Version :10

Sequence 1:NP_112533.1 Gene:HNRNPA2B1 / 3181 HGNCID:5033 Length:353 Species:Homo sapiens
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:75 Identity:26/75 - (34%)
Similarity:38/75 - (50%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   113 KLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTI 177
            |||||.:........||.||.:||.:...|::.|||.|..:.:|||.|...|..:....|..|.:
  Fly    11 KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHFL 75

Human   178 NGHNAEVRKA 187
            :|....|::|
  Fly    76 DGRVLTVQRA 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA2B1NP_112533.1 Nuclear localization signal. /evidence=ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155
RRM2_hnRNPA2B1 112..191 CDD:409995 26/75 (35%)
Disordered. /evidence=ECO:0000269|PubMed:26544936 193..353
HnRNPA1 302..326 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250 308..347
SLIRP2NP_649808.1 RRM_SF 11..83 CDD:473069 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.