DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA2B1 and Rbp6

DIOPT Version :10

Sequence 1:NP_112533.1 Gene:HNRNPA2B1 / 3181 HGNCID:5033 Length:353 Species:Homo sapiens
Sequence 2:NP_001097631.1 Gene:Rbp6 / 39919 FlyBaseID:FBgn0260943 Length:499 Species:Drosophila melanogaster


Alignment Length:151 Identity:37/151 - (24%)
Similarity:52/151 - (34%) Gaps:35/151 - (23%)


- Green bases have known domain annotations that are detailed below.


Human   174 PTQTPHQEAAPRASKGAQTGTLVEE-----MVAVASGTAGGDD-----GGAAGRPLTKAQPGHRS 228
            ||.:...:.|....:....|.:.|:     ||.:|..:||..|     ||..|.....|:..|  
  Fly     6 PTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAH-- 68

Human   229 YNLQERRRIGSMTGVEQALLPRVPTDESEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGST 293
                     |:.:|:..||....|..| :..|::.||        |..:.||    |.....|..
  Fly    69 ---------GANSGIHIALRLLDPIRE-QFPTISFAD--------FHQLAGV----VAVEVTGGP 111

Human   294 QAA-REGREPGPTPRARPRAP 313
            ... ..|||..|.|....|.|
  Fly   112 DIPFHPGREDKPQPPPEGRLP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA2B1NP_112533.1 Nuclear localization signal. /evidence=ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155
RRM2_hnRNPA2B1 112..191 CDD:409995 3/16 (19%)
Disordered. /evidence=ECO:0000269|PubMed:26544936 193..353 34/132 (26%)
HnRNPA1 302..326 CDD:463312 4/12 (33%)
Nuclear targeting sequence. /evidence=ECO:0000250 308..347 2/6 (33%)
Rbp6NP_001097631.1 RRM1_MSI 30..105 CDD:409990 24/98 (24%)
RRM2_MSI 119..192 CDD:240769 6/14 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.