DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA2B1 and cocoon

DIOPT Version :10

Sequence 1:NP_112533.1 Gene:HNRNPA2B1 / 3181 HGNCID:5033 Length:353 Species:Homo sapiens
Sequence 2:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:233 Identity:75/233 - (32%)
Similarity:111/233 - (47%) Gaps:31/233 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     2 EKTLETVPLERKKREKE-QFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFG 65
            |..||....:.|:.|.. :...|.:.|||:.|||:.||.|:|.:|.:....:.:|..|..|:|||
  Fly    87 EDNLENSTAKTKRTEAHLRCFDLIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFG 151

Human    66 FVTFSSMAEVDAAMAARPHSIDGRVVEPK----RAVAREESGKPGAHVTVKKLFVGGIKEDTEEH 126
            ||.|.|. :|...:.::.||||||..|.|    |.:..:|.|         |:|||...||.|..
  Fly   152 FVRFGSY-DVQMHVLSKRHSIDGRWCEVKVPASRGMGNQEPG---------KVFVGRCTEDIEAD 206

Human   127 HLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDP-VDKIVLQKYHTINGHNAEVRKALSR 190
            .||:||.::|::  |::...:..   |.|.||||  .|| |.::|..:.|.|.|.:..|..|..:
  Fly   207 DLREYFSKFGEV--IDVFIPKPF---RAFSFVTF--LDPYVPRVVCGEKHIIKGVSVHVSTADKK 264

Human   191 QEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFR 228
            ....:.|..::....|.        ..||...|.:|||
  Fly   265 NVQNKNQLFQTNNYNNL--------DNNFKMQPANNFR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA2B1NP_112533.1 Nuclear localization signal. /evidence=ECO:0000255 9..15 1/5 (20%)
RRM1_hnRNPA2B1 19..99 CDD:410155 32/83 (39%)
RRM2_hnRNPA2B1 112..191 CDD:409995 28/79 (35%)
Disordered. /evidence=ECO:0000269|PubMed:26544936 193..353 8/36 (22%)
HnRNPA1 302..326 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250 308..347
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 31/73 (42%)
RRM2_TDP43 193..262 CDD:409761 27/75 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.