DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA2B1 and CG3594

DIOPT Version :10

Sequence 1:NP_112533.1 Gene:HNRNPA2B1 / 3181 HGNCID:5033 Length:353 Species:Homo sapiens
Sequence 2:NP_523855.1 Gene:CG3594 / 37964 FlyBaseID:FBgn0035063 Length:250 Species:Drosophila melanogaster


Alignment Length:82 Identity:23/82 - (28%)
Similarity:39/82 - (47%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


Human    23 LFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSID 87
            |::..|:||||::.|..::...|.:..   :|.| .||..||.||..:.::....|.......:.
  Fly   116 LYVTNLNFETTKDDLELHFSAAGTVKS---IRIP-KKRRGGFAFVEMADLSSFQNAFQLHNTELQ 176

Human    88 GRVVEPKRAVAREESGK 104
            ||.::    |...|:||
  Fly   177 GRNIK----VQISEAGK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA2B1NP_112533.1 Nuclear localization signal. /evidence=ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155 20/75 (27%)
RRM2_hnRNPA2B1 112..191 CDD:409995
Disordered. /evidence=ECO:0000269|PubMed:26544936 193..353
HnRNPA1 302..326 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250 308..347
CG3594NP_523855.1 SF-CC1 36..>197 CDD:273721 23/82 (28%)
RRM 116..187 CDD:440488 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.