DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA2B1 and SLIRP1

DIOPT Version :10

Sequence 1:NP_112533.1 Gene:HNRNPA2B1 / 3181 HGNCID:5033 Length:353 Species:Homo sapiens
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:92 Identity:27/92 - (29%)
Similarity:53/92 - (57%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    96 AVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTF 160
            |.|..:.||     :|.::|||.:........||.||.|:|::.:..:|.|:::|..:|:|||:|
  Fly     4 AAAVAKVGK-----SVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSF 63

Human   161 DDHDPVDKIVLQKYHTINGHNAEVRKA 187
            :....::||..::.|.:.|:...::|:
  Fly    64 NSLTALEKIENEQKHILEGNYLNIQKS 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA2B1NP_112533.1 Nuclear localization signal. /evidence=ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155 1/2 (50%)
RRM2_hnRNPA2B1 112..191 CDD:409995 22/76 (29%)
Disordered. /evidence=ECO:0000269|PubMed:26544936 193..353
HnRNPA1 302..326 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250 308..347
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 21/71 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.