DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HNRNPA2B1 and CG10466

DIOPT Version :10

Sequence 1:NP_112533.1 Gene:HNRNPA2B1 / 3181 HGNCID:5033 Length:353 Species:Homo sapiens
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:110 Identity:27/110 - (24%)
Similarity:46/110 - (41%) Gaps:18/110 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   100 EESGKPGAHVTVKK---LFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFD 161
            :..||...|...|.   :||.|......|..|...|.:||::..|.:|.|.::||.:||.|:.::
  Fly    19 QHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYE 83

Human   162 DHDPVDKIVLQKYHTING-----------HNAEVRKALSRQEMQE 195
            |    .:..:.....:||           |.|:.:.....::|.|
  Fly    84 D----QRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENEKMDE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HNRNPA2B1NP_112533.1 Nuclear localization signal. /evidence=ECO:0000255 9..15
RRM1_hnRNPA2B1 19..99 CDD:410155
RRM2_hnRNPA2B1 112..191 CDD:409995 22/92 (24%)
Disordered. /evidence=ECO:0000269|PubMed:26544936 193..353 2/3 (67%)
HnRNPA1 302..326 CDD:463312
Nuclear targeting sequence. /evidence=ECO:0000250 308..347
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/91 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.