DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and THI21

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_015065.1 Gene:THI21 / 855870 SGDID:S000006179 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:245 Identity:50/245 - (20%)
Similarity:80/245 - (32%) Gaps:91/245 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PKSVSTAELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEP--------LAEESSTSQLRPL--- 57
            ||.|....|.:|| |:|.:...:::.:: :|||...||..|        |.|:...|:||.:   
Yeast   121 PKLVVDPVLVATS-GSSLAGKDIASLIT-EKIAPFADILTPNIPECFKLLGEDREISKLRDIFEV 183

  Fly    58 ----------------GTSIPTNSTASELKKS------------------NTSYSF-TGDYLSGG 87
                            |..||.|....:....                  ||:::. ||..|:..
Yeast   184 AKDLAKITKCSNILVKGGHIPWNDEEGKYITDVLYLGAEQRFITFKGNFVNTTHTHGTGCTLASA 248

  Fly    88 NKADLKGGYP-----FGGTDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWP 147
            ..::|..||.     :||.             |:..:.....|::..:|.||.          .|
Yeast   249 IASNLARGYSLPQSVYGGI-------------EYVQNAVAIGCDVTKETVKDN----------GP 290

  Fly   148 CLHQWLLTRPNRKL----CPVCKAAVDKDKVIPLYGRNSTHQEDPRNKVP 193
            ..|.:.:..|..|:    |.....||.|..|           :...||:|
Yeast   291 INHVYAIEIPLEKMLSDECFTASDAVHKKPV-----------KSSLNKIP 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 9/48 (19%)
THI21NP_015065.1 ThiD 22..298 CDD:223428 40/201 (20%)
TenA 331..551 CDD:223889
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1016
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.