DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and RMA2

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_194556.1 Gene:RMA2 / 828942 AraportID:AT4G28270 Length:193 Species:Arabidopsis thaliana


Alignment Length:128 Identity:51/128 - (39%)
Similarity:69/128 - (53%) Gaps:29/128 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EKDKEKEHTADDS--LYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRK----------- 160
            ||| |.:.|..||  .::||||||..:|.||::|||||||||:|:|.....|.:           
plant     4 EKD-EDDTTLVDSGGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKRE 67

  Fly   161 --LCPVCKAAVDKDKVIPLYGRNSTHQEDPR--NKVPPRPAGQRTEPDPVPGFPGFG--FGDG 217
              .|||||:.|.:..::|:|||.   |:.|:  :.||.||.|      ||....|.|  .|:|
plant    68 PPKCPVCKSDVSEATLVPIYGRG---QKAPQSGSNVPSRPTG------PVYDLRGVGQRLGEG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 26/57 (46%)
RMA2NP_194556.1 PLN03208 1..193 CDD:178747 51/128 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.