DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and RMA3

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_194477.2 Gene:RMA3 / 828856 AraportID:AT4G27470 Length:243 Species:Arabidopsis thaliana


Alignment Length:228 Identity:63/228 - (27%)
Similarity:94/228 - (41%) Gaps:72/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTR-------PNRK 160
            |..:|||          ...::||||||||.|.||::|||||||||:::||..:       .::.
plant    32 TAGQANE----------SGCFDCNICLDTAHDPVVTLCGHLFCWPCIYKWLHVQLSSVSVDQHQN 86

  Fly   161 LCPVCKAAVDKDKVIPLYGR---------NSTHQEDPRNKVPPRPAGQRTEPDPV-------PGF 209
            .|||||:.:....::|||||         .|..|:.....:|.|||..... :|:       |..
plant    87 NCPVCKSNITITSLVPLYGRGMSSPSSTFGSKKQDALSTDIPRRPAPSALR-NPITSASSLNPSL 150

  Fly   210 PGFGFGDGFH----------------------MSF---GIGAFP-------FGFITSRLNFFEPR 242
            ........||                      |||   .||.|.       ||..|:.:     .
plant   151 QHQTLSPSFHNHQYSPRGFTTTESTDLANAVMMSFLYPVIGMFGDLVYTRIFGTFTNTI-----A 210

  Fly   243 PPADIRRLHEDEPWALSKLFWHFVVFVIYGLLV 275
            .|...:|:.:.|. :|:::...|:..:|..||:
plant   211 QPYQSQRMMQREK-SLNRVSIFFLCCIILCLLL 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 27/51 (53%)
RMA3NP_194477.2 PLN03208 37..228 CDD:178747 57/207 (28%)
RING 43..95 CDD:238093 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.