DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and AT3G58030

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001190122.1 Gene:AT3G58030 / 824972 AraportID:AT3G58030 Length:436 Species:Arabidopsis thaliana


Alignment Length:188 Identity:70/188 - (37%)
Similarity:96/188 - (51%) Gaps:27/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WTRDITEPLAEESS------TSQLRPLGTSIP----TNSTASELKK-----SNTSYSFTGDYLSG 86
            ||.|..|..:|..:      .::.|.|...||    |::.|.||.:     .|.:...||:....
plant    36 WTNDPPERSSEAVTRIRTRHRTRFRQLNLPIPVLSETHTMAIELNQLMGNSVNRAAMQTGEGSER 100

  Fly    87 GNKADLK----GGYPFGGTDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWP 147
            ||: |||    |....|....|.||   |.||...:|.:.::||||||.:|:.|::.||||:|||
plant   101 GNE-DLKMCENGDGALGDGVLDKKA---DVEKSSGSDGNFFDCNICLDLSKEPVLTCCGHLYCWP 161

  Fly   148 CLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRN---KVPPRPAGQRTE 202
            ||:|||.. .:.|.|||||..|....|.|:|||.:..:|...:   |||.||..:|.|
plant   162 CLYQWLQI-SDAKECPVCKGEVTSKTVTPIYGRGNHKREIEESLDTKVPMRPHARRIE 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 26/44 (59%)
AT3G58030NP_001190122.1 PLN03208 134..>226 CDD:178747 40/86 (47%)
RING-HC_AtRMA_like 137..180 CDD:319659 25/43 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - mtm1175
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.