DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and AT2G44410

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_181969.2 Gene:AT2G44410 / 819048 AraportID:AT2G44410 Length:413 Species:Arabidopsis thaliana


Alignment Length:226 Identity:65/226 - (28%)
Similarity:92/226 - (40%) Gaps:31/226 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 STSTGASSSSSTLSNNVSYDKIAWTRDIT--EPLAEESSTSQ------LRPLGTSIP-------T 63
            |||....:....|:...|.|..:....:|  .|:.||..::|      :|.|...:.       |
plant     2 STSVQGETMDLDLNQEPSSDSESPGGLMTALSPMLEELESAQERIQERIRQLEVIVSRIREREIT 66

  Fly    64 NSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYECNIC 128
            .:|...|...|.....|...:...::..|...   |...|...|...:.||..:.....::||||
plant    67 TTTTPALVSPNEHRDSTAGVIHERSRERLVEN---GENKTYLIAKALNMEKTSSVPGGFFDCNIC 128

  Fly   129 LDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGR------NSTHQED 187
            |:.|:|.:::.|||||||.|.:|..|...|.|.||||...|...:|||:||.      .....||
plant   129 LEKAEDPILTCCGHLFCWGCFYQLPLIYLNIKECPVCDGEVTDAEVIPIYGNGDDCDGTKPKLED 193

  Fly   188 PRNKVPPRPAGQRTEP-------DPVPGFPG 211
            ....:||||..:|.|.       ...|.|||
plant   194 CGISLPPRPNAKRVESVRQKIINRGNPFFPG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 23/44 (52%)
AT2G44410NP_181969.2 PEX10 <71..175 CDD:227861 33/106 (31%)
RING_Ubox 123..165 CDD:418438 21/41 (51%)
RING-HC finger (C3HC4-type) 125..165 CDD:319361 21/39 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.