DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sordd2 and PEX10

DIOPT Version :10

Sequence 1:NP_727898.2 Gene:sordd2 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_565621.1 Gene:PEX10 / 817175 AraportID:AT2G26350 Length:381 Species:Arabidopsis thaliana


Alignment Length:125 Identity:35/125 - (28%)
Similarity:58/125 - (46%) Gaps:23/125 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ASELKKSNTSYSFT--------GDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTAD---- 119
            |..|::||.| |.|        |.|.:.|.:     |.|....:.:...:|.:|....|:|    
plant   263 AEGLRRSNLS-SITSSIQQASIGSYQTSGGR-----GLPVLNEEGNLITSEAEKGNWSTSDSTST 321

  Fly   120 DSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKL-CPVCKAAVDKDKVIPLY 178
            :::.:|.:||.|.:....:.|||:|||.|:.:|.    |.|. ||:|:.......::.||
plant   322 EAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWC----NEKQECPLCRTPNTHSSLVCLY 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sordd2NP_727898.2 RING-HC_RNF185 123..179 CDD:438402 19/57 (33%)
PEX10NP_565621.1 Pex2_Pex12 41..273 CDD:398431 5/10 (50%)
RING-HC_PEX10 326..376 CDD:438190 17/53 (32%)

Return to query results.
Submit another query.