DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and AT2G23780

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001318276.1 Gene:AT2G23780 / 816910 AraportID:AT2G23780 Length:227 Species:Arabidopsis thaliana


Alignment Length:167 Identity:64/167 - (38%)
Similarity:86/167 - (51%) Gaps:36/167 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GGTDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCP 163
            |.:.|.|..::.:.:......|  :|||||.:.|:|.:|::||||||||||::||....:.:.||
plant     4 GESSTSTSYSDSNNDTNDQGGD--FECNICFELAQDPIVTLCGHLFCWPCLYRWLHHHSHSQECP 66

  Fly   164 VCKAAVDKDKVIPLYGRNSTHQEDPRNK------VPPRPAGQRTE---PDPVP----GFPGFGFG 215
            ||||.|..||::|||||.. :|.|||:|      :|.||.|||.|   |.|.|    .|..:|.|
plant    67 VCKAVVQDDKLVPLYGRGK-NQTDPRSKRYPGLRIPNRPTGQRPETAAPPPQPEAASNFFNYGIG 130

  Fly   216 --------------DGFHMSFGIGAFPFGFITSRLNF 238
                          ..|.|.||      |.:.|..||
plant   131 LMGGIMPMMATTRFGNFSMGFG------GLLPSLFNF 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 26/44 (59%)
AT2G23780NP_001318276.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 78 1.000 Domainoid score I3052
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I2031
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - mtm1175
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.