DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and Rnf180

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_006517824.4 Gene:Rnf180 / 71816 MGIID:1919066 Length:641 Species:Mus musculus


Alignment Length:297 Identity:68/297 - (22%)
Similarity:111/297 - (37%) Gaps:85/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SSSTLSNNVSYDKIAWT-------RDITEPLAEESSTSQLR-------PLGT--SIPTNSTASEL 70
            :||..|::.:.:.:.:.       |.:.|...:|...|||.       ||||  ....|...|:|
Mouse   366 ASSVYSDHANANSLPFLMDLPSAGRSVLEASDQEEHLSQLDFLRSASFPLGTINHRLNNRERSKL 430

  Fly    71 K------------KSNTSYSFTG--DYLSGGNKADLKGGYPFGGTDTDTK-ANEKDKEKEHTADD 120
            :            :....||..|  |:::..|:.         .||.:|: ..|||.        
Mouse   431 RTLRRQQRRERWLQKQGKYSGVGLLDHMTVSNEM---------STDEETEFPEEKDS-------- 478

  Fly   121 SLYECNICLDTAKDAVVSM-CGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTH 184
              |.|.:|||...:..:.. |.|:||.|||.......|....||:|:..:.: ..:.....|:|.
Mouse   479 --YMCAVCLDVYFNPYMCYPCHHIFCEPCLRTLAKDNPASTPCPLCRTIISR-VFLQTELNNATK 540

  Fly   185 QEDPRNKVPPRPAGQRTEPD--PVP----GFPGFGFGDGFHMSFG---IGAFPFGFITSRLNFFE 240
            ....:..:..:.:.|::...  |:|    ||..||   |||....   ...||.|  ..|:::  
Mouse   541 TFFTKEYLKIKQSFQKSSSAKWPLPSCRKGFHLFG---GFHRRAAPVTRRQFPHG--AHRMDY-- 598

  Fly   241 PRPPADIRRLH-EDEPWALSKLFW---HFVVFVIYGL 273
                     || ||:    |:.:|   ..|:..||.:
Mouse   599 ---------LHFEDD----SRGWWFDMDMVIIYIYSV 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 15/45 (33%)
Rnf180XP_006517824.4 RING-HC_RNF180 481..523 CDD:319468 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.