powered by:
Protein Alignment CG32581 and Pex10
DIOPT Version :9
Sequence 1: | NP_001096988.2 |
Gene: | CG32581 / 318098 |
FlyBaseID: | FBgn0052581 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102875.1 |
Gene: | Pex10 / 680424 |
RGDID: | 1591776 |
Length: | 324 |
Species: | Rattus norvegicus |
Alignment Length: | 53 |
Identity: | 18/53 - (33%) |
Similarity: | 30/53 - (56%) |
Gaps: | 3/53 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
|.:||:..:.:..:.|||||||.|:.:|..|:.. ||:|:......|::.|
Rat 271 CTLCLEERRHSTATPCGHLFCWECITEWCNTKTE---CPLCREKFPPQKLVYL 320
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32581 | NP_001096988.2 |
RING |
124..169 |
CDD:238093 |
16/43 (37%) |
Pex10 | NP_001102875.1 |
Pex2_Pex12 |
16..216 |
CDD:282595 |
|
zf-RING_2 |
271..309 |
CDD:290367 |
15/40 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.