DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and RNF4

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001171938.1 Gene:RNF4 / 6047 HGNCID:10067 Length:190 Species:Homo sapiens


Alignment Length:83 Identity:25/83 - (30%)
Similarity:35/83 - (42%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 TDTKANEKDKEKEHTADDSLYECNICLDTAKDAV------VSM-CGHLFCWPCLHQWLLTRPNRK 160
            |.|..|.:|:............|.||:|...:.|      ||. |||:||..||...|   .|..
Human   110 THTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSL---KNAN 171

  Fly   161 LCPVCKAAVDKDKVIPLY 178
            .||.|:..::..:..|:|
Human   172 TCPTCRKKINHKRYHPIY 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 19/51 (37%)
RNF4NP_001171938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Required for ubiquitination activity. /evidence=ECO:0000250 1..16
Mediates interaction with TRPS1. /evidence=ECO:0000250 4..61
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 36..39
SUMO interaction motif 2. /evidence=ECO:0000269|PubMed:18408734 46..49
SUMO interaction motif 3. /evidence=ECO:0000269|PubMed:18408734 57..59
SUMO interaction motif 4. /evidence=ECO:0000269|PubMed:18408734 67..70
RING-HC_RNF4 127..180 CDD:319447 19/55 (35%)
RING-HC finger (C3HC4-type) 132..176 CDD:319447 18/46 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.