DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and RNF20

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_062538.5 Gene:RNF20 / 56254 HGNCID:10062 Length:975 Species:Homo sapiens


Alignment Length:61 Identity:21/61 - (34%)
Similarity:30/61 - (49%) Gaps:11/61 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQ 185
            |..|....||||::.|.|:||:.|:.....||  ::.||.|.||         :|.|..|:
Human   922 CPCCNMRKKDAVLTKCFHVFCFECVKTRYDTR--QRKCPKCNAA---------FGANDFHR 971

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 17/43 (40%)
RNF20NP_062538.5 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
SMC_prok_B 44..>759 CDD:274008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..155
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..622
Smc 622..>920 CDD:224117
RING-HC_RNF20_like 920..965 CDD:319618 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.