DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and Rnf5

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_062276.1 Gene:Rnf5 / 54197 MGIID:1860076 Length:180 Species:Mus musculus


Alignment Length:176 Identity:90/176 - (51%)
Similarity:113/176 - (64%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ANEKD-----KEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCK 166
            |.|:|     ..:|.....:.:||||||:||::||||:||||:|||||||||.|||:|:.|||||
Mouse     4 AEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDRQECPVCK 68

  Fly   167 AAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGF 231
            |.:.::||:|||||.|...:|||.|.||||.|||..|:...||..||...|||.|||:|||||||
Mouse    69 AGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFHFSFGVGAFPFGF 133

  Fly   232 ITSRLNFFEP-RPPA--DIRRLHEDEPWALSKLFWHFVVFVIYGLL 274
            .|:..|..|| |..|  |:.:.|....|. ..||....:|..:.||
Mouse   134 FTTVFNAHEPFRRGAGVDLGQGHPASSWQ-DSLFLFLAIFFFFWLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 35/44 (80%)
Rnf5NP_062276.1 PLN03208 25..>117 CDD:178747 59/91 (65%)
RING-HC_RNF5 25..70 CDD:319657 34/44 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842613
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.740

Return to query results.
Submit another query.