DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and rnf185

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_031753424.1 Gene:rnf185 / 448093 XenbaseID:XB-GENE-998723 Length:189 Species:Xenopus tropicalis


Alignment Length:180 Identity:103/180 - (57%)
Similarity:125/180 - (69%) Gaps:12/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GGTDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCP 163
            ||....|..       |.::.||.:|||||||||||||:|:||||||||||||||.|||||::||
 Frog    18 GGASGSTNG-------EASSQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQWLETRPNRQVCP 75

  Fly   164 VCKAAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQRTEPDPVPGFPGFGFGD-GFHMSFGIGAF 227
            ||||.:.::||||||||.||.|||||.|.||||.|||.||:. .||.|||||| ||.||||||||
 Frog    76 VCKAGISREKVIPLYGRGSTGQEDPREKTPPRPQGQRPEPEN-RGFQGFGFGDGGFQMSFGIGAF 139

  Fly   228 PFGFITSRLNFFEPRPPADI--RRLHEDEPWALSKLFWHFVVFVIYGLLV 275
            |||...:..|..:.|||..:  ...:.||.: ||:||....:.:::.||:
 Frog   140 PFGIFATAFNINDGRPPPAVPGTPQYVDEQF-LSRLFLFVALVIMFWLLI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 39/44 (89%)
rnf185XP_031753424.1 RING-HC_RNF185 36..78 CDD:319658 36/41 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4978
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 214 1.000 Inparanoid score I3531
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - otm49469
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.