DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and CG8141

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_731776.1 Gene:CG8141 / 41622 FlyBaseID:FBgn0038125 Length:239 Species:Drosophila melanogaster


Alignment Length:285 Identity:70/285 - (24%)
Similarity:103/285 - (36%) Gaps:103/285 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EPLAEESSTSQLRPLGTSIPTNSTASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKA 107
            |.:|.|:.......:...:|.|.||     .|.|:...|:.:|.|...||          ::...
  Fly     2 EAVARENDPPNHCYINEEVPANETA-----ENPSHGLQGEVISKGYIPDL----------SNANV 51

  Fly   108 NEKDKEKEHTADDSL----------------YECNICLDTAKDAVVSMCGHLFCWPCLHQW-LLT 155
            |::.:::....||.|                |.||.|....:..|:::|||||||.||  | .|:
  Fly    52 NQQQQQENDGEDDLLPGTRLRYRRRNLHLDPYVCNECNQYVRGGVITICGHLFCWTCL--WPKLS 114

  Fly   156 RPNRKLCPVC-KAAVDKDKVIPLYGRN-STHQEDPRNKVP------PRPAGQRTEP--------- 203
            ...:..||.| :..:..:.::|.:|.. :..|||  |.||      |||.|.....         
  Fly   115 GTAQPRCPCCQRHLLMYEDIMPFHGEGPNARQED--NNVPAQPGSVPRPTGLYLSDTDFPCWFAV 177

  Fly   204 -DPVPGFPGFGFGDGFHMSFGIGAFPFGFITSRLNFFEPRPPADIRR---LH-------EDEPW- 256
             |||.|.|              ..||                 ||||   ||       ...|| 
  Fly   178 NDPVDGCP--------------ATFP-----------------DIRRERDLHCAIRLIPMVYPWI 211

  Fly   257 --ALSKLFWH-----FVVFVIYGLL 274
              .:|.|.|.     .::|:|:.:|
  Fly   212 GAQISFLKWFQLGCVLLIFLIWSVL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 18/46 (39%)
CG8141NP_731776.1 zf-C3HC4_2 85..124 CDD:290634 17/40 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.