DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and Rnf5

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001102495.1 Gene:Rnf5 / 407784 RGDID:1588458 Length:180 Species:Rattus norvegicus


Alignment Length:176 Identity:90/176 - (51%)
Similarity:113/176 - (64%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ANEKD-----KEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCK 166
            |.|:|     ..:|.....:.:||||||:||::||||:||||:|||||||||.|||:|:.|||||
  Rat     4 AEEEDGGPEGPNRERGGASATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPDRQECPVCK 68

  Fly   167 AAVDKDKVIPLYGRNSTHQEDPRNKVPPRPAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGF 231
            |.:.::||:|||||.|...:|||.|.||||.|||..|:...||..||...|||.|||:|||||||
  Rat    69 AGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDAGGFHFSFGVGAFPFGF 133

  Fly   232 ITSRLNFFEP-RPPA--DIRRLHEDEPWALSKLFWHFVVFVIYGLL 274
            .|:..|..|| |..|  |:.:.|....|. ..||....:|..:.||
  Rat   134 FTTVFNAHEPFRRGAGVDLGQGHPASSWQ-DSLFLFLAIFFFFWLL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 35/44 (80%)
Rnf5NP_001102495.1 PLN03208 25..>117 CDD:178747 59/91 (65%)
RING-HC_RNF5 25..70 CDD:319657 34/44 (77%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 17/30 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346071
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.