DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and Pex10

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001261265.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster


Alignment Length:59 Identity:23/59 - (38%)
Similarity:37/59 - (62%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
            |.:..:|.:||:...|:.::.|||:|||.||.:||   ..|..||:|:.::.|.:||.|
  Fly   240 DPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWL---EERDECPLCRESLKKSQVILL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 18/44 (41%)
Pex10NP_001261265.1 Pex2_Pex12 20..>173 CDD:282595
zf-RING_2 244..284 CDD:290367 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.