powered by:
Protein Alignment CG32581 and Pex10
DIOPT Version :9
Sequence 1: | NP_001096988.2 |
Gene: | CG32581 / 318098 |
FlyBaseID: | FBgn0052581 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001261265.1 |
Gene: | Pex10 / 38182 |
FlyBaseID: | FBgn0035233 |
Length: | 299 |
Species: | Drosophila melanogaster |
Alignment Length: | 59 |
Identity: | 23/59 - (38%) |
Similarity: | 37/59 - (62%) |
Gaps: | 3/59 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 DDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
|.:..:|.:||:...|:.::.|||:|||.||.:|| ..|..||:|:.::.|.:||.|
Fly 240 DPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWL---EERDECPLCRESLKKSQVILL 295
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32581 | NP_001096988.2 |
RING |
124..169 |
CDD:238093 |
18/44 (41%) |
Pex10 | NP_001261265.1 |
Pex2_Pex12 |
20..>173 |
CDD:282595 |
|
zf-RING_2 |
244..284 |
CDD:290367 |
17/42 (40%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5574 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R146 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.