DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sordd2 and Pex10

DIOPT Version :10

Sequence 1:NP_727898.2 Gene:sordd2 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_647624.1 Gene:Pex10 / 38182 FlyBaseID:FBgn0035233 Length:299 Species:Drosophila melanogaster


Alignment Length:59 Identity:23/59 - (38%)
Similarity:37/59 - (62%) Gaps:3/59 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
            |.:..:|.:||:...|:.::.|||:|||.||.:||   ..|..||:|:.::.|.:||.|
  Fly   240 DPNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWL---EERDECPLCRESLKKSQVILL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sordd2NP_727898.2 RING-HC_RNF185 123..179 CDD:438402 22/55 (40%)
Pex10NP_647624.1 Pex2_Pex12 20..>173 CDD:398431
HRD1 <183..>287 CDD:227568 19/49 (39%)
RING-HC_PEX10 244..295 CDD:438190 21/53 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.