DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and si:busm1-163l24.4

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001005315.1 Gene:si:busm1-163l24.4 / 368754 ZFINID:ZDB-GENE-030616-180 Length:278 Species:Danio rerio


Alignment Length:173 Identity:42/173 - (24%)
Similarity:54/173 - (31%) Gaps:68/173 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 ADDSL-----YECNICLDTAKDAVVSMCGHLFCWPCL-HQWLL---------------------- 154
            ||.||     :.|.||||..||.|...|||.:|..|: |.|..                      
Zfish     2 ADKSLEDLDPFTCPICLDALKDPVTIPCGHNYCMSCIKHYWEKNGSRDTGYTCPECRKTFSPRPA 66

  Fly   155 ---------------------TRPNRKLCPV------CKAAVDKD-KVIPLYGRNSTHQEDPRNK 191
                                 |.|.|.:.||      |.:...|| :::|...|.....:.||.|
Zfish    67 LNKNTMFAEVVERFKNTGLQDTSPARYMTPVHTERQNCTSQNPKDSRILPEMDRTHLRYDSPREK 131

  Fly   192 -----VPPRPAG-----QRTEPDPVPGFPGFGFGDGF--HMSF 222
                 |...|.|     .||.|.....|....|.:.:  |.:|
Zfish   132 HTVIVVAGEPKGNICSRHRTAPGVCSQFCASCFDEAWREHKAF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 21/94 (22%)
si:busm1-163l24.4NP_001005315.1 zf-C3HC4_4 14..57 CDD:291880 15/42 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.