powered by:
Protein Alignment CG32581 and Y47G6A.31
DIOPT Version :9
Sequence 1: | NP_001096988.2 |
Gene: | CG32581 / 318098 |
FlyBaseID: | FBgn0052581 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021767.2 |
Gene: | Y47G6A.31 / 3565969 |
WormBaseID: | WBGene00044436 |
Length: | 185 |
Species: | Caenorhabditis elegans |
Alignment Length: | 61 |
Identity: | 22/61 - (36%) |
Similarity: | 32/61 - (52%) |
Gaps: | 8/61 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 121 SLYECNICLDTAKD-----AVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIP 176
|..||:||.....| .::..|||.||:.||..|| .::..||:|:.||:..:.||
Worm 3 SRLECSICFFDFDDFQHLPKLLENCGHTFCYSCLFDWL---KSQDTCPMCREAVNMTQEIP 60
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32581 | NP_001096988.2 |
RING |
124..169 |
CDD:238093 |
17/49 (35%) |
Y47G6A.31 | NP_001021767.2 |
RAD18 |
3..>51 |
CDD:227719 |
18/50 (36%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R146 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.950 |
|
Return to query results.
Submit another query.