DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sordd2 and Y47G6A.31

DIOPT Version :10

Sequence 1:NP_727898.2 Gene:sordd2 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001021767.2 Gene:Y47G6A.31 / 3565969 WormBaseID:WBGene00044436 Length:185 Species:Caenorhabditis elegans


Alignment Length:61 Identity:22/61 - (36%)
Similarity:32/61 - (52%) Gaps:8/61 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SLYECNICLDTAKD-----AVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIP 176
            |..||:||.....|     .::..|||.||:.||..||   .::..||:|:.||:..:.||
 Worm     3 SRLECSICFFDFDDFQHLPKLLENCGHTFCYSCLFDWL---KSQDTCPMCREAVNMTQEIP 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sordd2NP_727898.2 RING-HC_RNF185 123..179 CDD:438402 21/59 (36%)
Y47G6A.31NP_001021767.2 RAD18 3..>51 CDD:227719 18/50 (36%)

Return to query results.
Submit another query.