DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and CG8974

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_573076.1 Gene:CG8974 / 32532 FlyBaseID:FBgn0030693 Length:277 Species:Drosophila melanogaster


Alignment Length:274 Identity:254/274 - (92%)
Similarity:260/274 - (94%) Gaps:4/274 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEPKSVSTAELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESSTSQLRPLGTSIPTNS 65
            |||||||.|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MEEPKSVPTAELPSTSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESSTSQLRPLGTSIPTNS 65

  Fly    66 TASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYECNICLD 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 TASELKKSNTSYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYECNICLD 130

  Fly   131 TAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRNKVPPR 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 TAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRNKVPPR 195

  Fly   196 PAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSRLNFFEPRPPADIR--RLHEDEPWAL 258
            |||||||||||||||||||||||||||||||||||||||.|||.||||||..|  |.:|||. .|
  Fly   196 PAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSTLNFGEPRPPAANRGTRQYEDEQ-TL 259

  Fly   259 SKLFWHF-VVFVIY 271
            ||||.:. ||::::
  Fly   260 SKLFSYLAVVWILW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 44/44 (100%)
CG8974NP_573076.1 RING 124..169 CDD:238093 44/44 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457061
Domainoid 1 1.000 78 1.000 Domainoid score I3052
eggNOG 1 0.900 - - E1_COG5574
Homologene 1 1.000 - - H34298
Inparanoid 1 1.050 114 1.000 Inparanoid score I2031
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 1 1.000 - - otm26352
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - P PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
1211.820

Return to query results.
Submit another query.