DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and pas4

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_595592.1 Gene:pas4 / 2539774 PomBaseID:SPBC17A3.10 Length:306 Species:Schizosaccharomyces pombe


Alignment Length:163 Identity:40/163 - (24%)
Similarity:67/163 - (41%) Gaps:29/163 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TSTGASSSSSTLSNNVSYDKIAWTRDITEPLAEESSTSQLRPLGTSIPTNSTASELKKSNTSYSF 79
            |..|..::.|.|...:.|..:    |...|..::...:.|..||:.:    .||.|:.|| ||..
pombe   172 TMKGHCATVSQLLLGLKYISL----DEINPEEKKKVLTLLLLLGSRL----IASILQHSN-SYFD 227

  Fly    80 TGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYECNICLDTAKDAVVSMCGHLF 144
            .....|..::.||                 :||.|.....:...:|::|::.......:.|||:|
pombe   228 QHTISSITDERDL-----------------EDKNKLPFIPEGNRKCSLCMEFIHCPAATECGHIF 275

  Fly   145 CWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPL 177
            ||.|::.|   ...:..||:|:|.....|:|.|
pombe   276 CWSCINGW---TSKKSECPLCRAFSSPSKIILL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 14/44 (32%)
pas4NP_595592.1 PEX10 1..306 CDD:227861 40/163 (25%)
RING 255..295 CDD:238093 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.