powered by:
Protein Alignment CG32581 and CG44271
DIOPT Version :9
Sequence 1: | NP_001096988.2 |
Gene: | CG32581 / 318098 |
FlyBaseID: | FBgn0052581 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285689.1 |
Gene: | CG44271 / 19835868 |
FlyBaseID: | FBgn0265257 |
Length: | 106 |
Species: | Drosophila melanogaster |
Alignment Length: | 57 |
Identity: | 20/57 - (35%) |
Similarity: | 26/57 - (45%) |
Gaps: | 11/57 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 111 DKEKEHTADDSLYECNICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNR-KLCPVCK 166
|:...| |.|.||:......|.:.|||:||..| |.|..|: ..||:||
Fly 49 DRNNGH------YLCPICMSLPDHPVATTCGHIFCKEC----LTTALNQLHYCPLCK 95
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32581 | NP_001096988.2 |
RING |
124..169 |
CDD:238093 |
17/44 (39%) |
CG44271 | NP_001285689.1 |
RING |
57..95 |
CDD:238093 |
15/41 (37%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.