DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and sli-1

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_508145.2 Gene:sli-1 / 180419 WormBaseID:WBGene00004829 Length:582 Species:Caenorhabditis elegans


Alignment Length:129 Identity:32/129 - (24%)
Similarity:46/129 - (35%) Gaps:30/129 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 YPFGGTDTDTKAN------EKDKEKEHTADDSLY--------ECNICLDTAKDAVVSMCGHLFCW 146
            || .|.|.|...:      :.|:.:..:....||        .|.||.|..|:..:..||||.|.
 Worm   348 YP-NGRDQDINLSKLMDVPQADRVQVTSEQYELYCEMGTTFELCKICDDNEKNIKIEPCGHLLCA 411

  Fly   147 PCLHQWLLTRPNRKLCPVC--------KAAVDKDKVIPLYGRNSTHQEDPRNK-------VPPR 195
            .||..|..:......||.|        :..:|:.|..|:....:.:......|       ||||
 Worm   412 KCLANWQDSDGGGNTCPFCRYEIKGTNRVIIDRFKPTPVEIEKAKNVAAAEKKLISLVPDVPPR 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 16/52 (31%)
sli-1NP_508145.2 Cbl_N 67..183 CDD:280432
Cbl_N2 187..271 CDD:280857
SH2_Cbl-b_TKB 265..361 CDD:198176 5/13 (38%)
RING 390..434 CDD:238093 16/43 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.