DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and rnf5

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_003200552.1 Gene:rnf5 / 100537822 ZFINID:ZDB-GENE-100805-3 Length:205 Species:Danio rerio


Alignment Length:223 Identity:106/223 - (47%)
Similarity:132/223 - (59%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ASELKKSNT------SYSFTGDYLSGGNKADLKGGYPFGGTDTDTKANEKDKEKEHTADDSLYEC 125
            |:|.::|::      ...|.|   |||      |..|.||.:     .|:|:|:      :.:||
Zfish     3 AAEQQRSSSDGAAARGAGFPG---SGG------GAGPGGGAE-----GERDRER------ATFEC 47

  Fly   126 NICLDTAKDAVVSMCGHLFCWPCLHQWLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQEDPRN 190
            |||||||:|||:|:||||||||||||||.|||:|:.||||||.:.:|||||||||.|:.|||||.
Zfish    48 NICLDTARDAVISLCGHLFCWPCLHQWLETRPSRQQCPVCKAGISRDKVIPLYGRGSSSQEDPRL 112

  Fly   191 KVPPRPAGQRTEPDPVPGFPGFGFGDGFHMSFGIGAFPFGFITSRLNFFEPRPPADI-------- 247
            |.||||.|||:||:....|.||| ..|||||||||||||||.|:..|...|...||.        
Zfish   113 KTPPRPQGQRSEPESRGPFQGFG-DTGFHMSFGIGAFPFGFFTTVFNTNNPFHRADAHYGADQQA 176

  Fly   248 -RRLHEDEPWALSKLFWHFVVFVIYGLL 274
             ...:....|. ..||....:|..:.:|
Zfish   177 NENANNGNNWQ-DSLFLFLAIFFFFWIL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 37/44 (84%)
rnf5XP_003200552.1 PLN03208 45..>141 CDD:178747 68/96 (71%)
RING 46..91 CDD:238093 37/44 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587028
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 1 1.000 - - FOG0000717
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102074
Panther 1 1.100 - - O PTHR12313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R146
SonicParanoid 1 1.000 - - X682
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.