powered by:
Protein Alignment CG32581 and LOC100495443
DIOPT Version :9
Sequence 1: | NP_001096988.2 |
Gene: | CG32581 / 318098 |
FlyBaseID: | FBgn0052581 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002943039.2 |
Gene: | LOC100495443 / 100495443 |
-ID: | - |
Length: | 542 |
Species: | Xenopus tropicalis |
Alignment Length: | 74 |
Identity: | 24/74 - (32%) |
Similarity: | 32/74 - (43%) |
Gaps: | 13/74 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 CNICLDTAKDAVVSMCGHLFCWPCLHQWLLTR--PNRKLCPVCKAAVDKDKVIPLYGRNST---- 183
|:||||.....|:..|||.||..|:.:.|.:: .....||.|:|...|. |...||.|
Frog 36 CSICLDLYTHPVMLPCGHNFCQGCIKEVLNSQGGSGGYSCPECRAEYQKR---PALQRNWTLGNI 97
Fly 184 ----HQEDP 188
|..:|
Frog 98 AERFHSAEP 106
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.