DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32581 and XB5836481

DIOPT Version :9

Sequence 1:NP_001096988.2 Gene:CG32581 / 318098 FlyBaseID:FBgn0052581 Length:283 Species:Drosophila melanogaster
Sequence 2:XP_002941273.1 Gene:XB5836481 / 100490164 XenbaseID:XB-GENE-5836482 Length:536 Species:Xenopus tropicalis


Alignment Length:79 Identity:21/79 - (26%)
Similarity:33/79 - (41%) Gaps:15/79 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 CNICLDTAKDAVVSMCGHLFCWPCLHQ---WLLTRPNRKLCPVCKAAVDKDKVIPLYGRNST--- 183
            |.:||:...:.|...|||.||..|:.:   |......:..||.|:   ::.:..|...:||.   
 Frog    13 CTVCLNIYTEPVTLPCGHNFCLSCIGKTWDWQEGIEEQPSCPECR---ERFRTRPELKKNSRLRN 74

  Fly   184 -----HQEDPR-NK 191
                 ..|.|: ||
 Frog    75 IAEHFRSEQPKQNK 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32581NP_001096988.2 RING 124..169 CDD:238093 14/46 (30%)
XB5836481XP_002941273.1 RING 13..56 CDD:302633 13/42 (31%)
BBOX 137..177 CDD:197662
iSH2_PI3K_IA_R 203..299 CDD:304922
SPRY_PRY_C-I_2 358..535 CDD:293949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1510545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.