powered by:
Protein Alignment CG32581 and btr24
DIOPT Version :9
Sequence 1: | NP_001096988.2 |
Gene: | CG32581 / 318098 |
FlyBaseID: | FBgn0052581 |
Length: | 283 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017207881.1 |
Gene: | btr24 / 100000030 |
ZFINID: | ZDB-GENE-070705-376 |
Length: | 555 |
Species: | Danio rerio |
Alignment Length: | 70 |
Identity: | 22/70 - (31%) |
Similarity: | 28/70 - (40%) |
Gaps: | 18/70 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 ECNICLDTAKDAVVSMCGHLFCWPCLHQ-WLLTRPNRKLCPVCKAAVDKDKVIPLYGRNSTHQED 187
:|:||||...|.|.:.|||.||..||:. | .......||.| |.|..:.
Zfish 38 QCSICLDVFTDPVSTPCGHNFCKSCLNTCW--NNSQTCSCPYC---------------NETFTQR 85
Fly 188 PRNKV 192
|..|:
Zfish 86 PDLKI 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1510545at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.