DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc14A and CG13252

DIOPT Version :9

Sequence 1:NP_727928.3 Gene:Muc14A / 318097 FlyBaseID:FBgn0052580 Length:16223 Species:Drosophila melanogaster
Sequence 2:NP_649248.3 Gene:CG13252 / 40289 FlyBaseID:FBgn0037016 Length:384 Species:Drosophila melanogaster


Alignment Length:397 Identity:81/397 - (20%)
Similarity:137/397 - (34%) Gaps:146/397 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   909 STSRSNQPLPTKLHSVK------------DNAPHSL-------TNANPESLTSKDLTTKGNGVTD 954
            :|:...:|||....|||            .:..|:|       :|| .|...:.::.:..:||:.
  Fly    26 ATTLDQEPLPDLCQSVKCPPDAEMQCPADSSIRHNLLAVDLIKSNA-VELPNASEMASAADGVSY 89

  Fly   955 NKITTLSKLSSDNVCECTCLLEQGNDSCTC------NCMTDTNSIDESILTASQIVSSEDLQYSS 1013
            |:    ..:|.::..:| ||    |..|.|      :|.:|.   ||.::....:          
  Fly    90 NR----GLISDEDYVQC-CL----NRKCVCKTCYIPDCPSDA---DEDVVVVELV---------- 132

  Fly  1014 NPPSYKSTQENTNTKGKNKNLSTLLQISSTGPYQIYQSEIGNQSQYVPPSSTLFSDITKISNTDK 1078
                    .||..|.|:           ..|.|:. |:|         |:.|:..|      ||.
  Fly   133 --------PENNQTPGE-----------CCGTYEC-QAE---------PNCTVVRD------TDF 162

  Fly  1079 D-----------------HPTLDEE-ENISKSPLHLSTTSSSLPKIQITGVSHLPFLSTISNIKF 1125
            .                 |.|.||. |.:.:|              :|:|:.:....:...|.| 
  Fly   163 HWLKQCRRCKCESGLKICHKTCDERAEGVCQS--------------KISGMFYKDGENWTENCK- 212

  Fly  1126 EQSSFHGCDCTCQLEIGKDSCICE-CNLKESTSEGLKSVTASSLYIYLPQSSTTAHSLLTDLSAE 1189
                      ||:.|.|:..|... |......||....:..:...:..|:.:...|....|.|.|
  Fly   213 ----------TCECEKGEPKCTMSFCGNLNCPSEQQVMLKDTCCPVCWPKCAPMPHEKQDDGSYE 267

  Fly  1190 NQTNQEETSELSESLP-----QLTTEESSSFQESSAEENQMTEVPWTLTTSLSQSSSKTKNIFSS 1249
            :..::.||.| .:|||     .|||::|:             |:..|.||:.|..::.|..:..:
  Fly   268 DYVDESETPE-EDSLPPLLPDPLTTQQSA-------------ELVATSTTTSSNGTTSTTVVPLA 318

  Fly  1250 LSVNEDN 1256
            .:||.:|
  Fly   319 ATVNCNN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc14ANP_727928.3 PRK14949 <11377..11776 CDD:237863
PRK08581 11922..>12215 CDD:236304
PRK14949 <13679..14114 CDD:237863
PRK14949 <14663..15055 CDD:237863
CG13252NP_649248.3 VWC 197..249 CDD:302663 11/62 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.