DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc14A and Rcd2

DIOPT Version :9

Sequence 1:NP_727928.3 Gene:Muc14A / 318097 FlyBaseID:FBgn0052580 Length:16223 Species:Drosophila melanogaster
Sequence 2:NP_649244.3 Gene:Rcd2 / 40283 FlyBaseID:FBgn0037012 Length:452 Species:Drosophila melanogaster


Alignment Length:269 Identity:68/269 - (25%)
Similarity:108/269 - (40%) Gaps:60/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1891 SSSFQESSAKENHMTEVPWTLSTSLSKSSSKTKNIFSSLSVNEDNISQEDTRTPSISVPQSIATA 1955
            :|.:.:.:.|..:.|..| .|..|.|.||..:..:            ..||   |.|||.:..:.
  Fly   176 NSIYDDGNHKYRNTTSAP-ILGESESSSSGWSSTV------------PTDT---SDSVPDTSGSP 224

  Fly  1956 KSLLTGSSAEEQTAQEETSELSKSLPQLTTEESSSFQESSACSAGSSAEEQTAQEETSELSKSLP 2020
            .|  :.:|:|..|....|||||.|     ||.:|:          .|:.||..:..|||    .|
  Fly   225 NS--SSTSSELATPTPNTSELSSS-----TERTST----------DSSYEQLGEFATSE----SP 268

  Fly  2021 QLTTEESSSFQESSAEENQM--TEVPWTLSTSLSQSSSKTKNIFSSQSVNEDNISQ----EDTRT 2079
            .|.|:  |..||:|:.::.|  |..|.|...:.:.:.|.|.  ....:..:|.|::    .|.||
  Fly   269 DLRTD--SEEQETSSSDSAMETTTNPTTFEATATSTVSSTS--MELPTATDDGITKMDFNPDGRT 329

  Fly  2080 PSISVPQSIATAN-----SLLTGSSAEEQ---TAQEETSELSKSLPQLTTEESSSLQESSAE-EN 2135
            |..:...::...|     |::|.:....|   .|.|.||::.    .|.:.|...::...|| ..
  Fly   330 PKATDEPTVILVNATNFLSVVTDNPITNQPAVVAPESTSQIK----DLNSMEIQQIRYPYAEVPQ 390

  Fly  2136 EMTEVPWTL 2144
            |..:..|.|
  Fly   391 ERIQTDWPL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc14ANP_727928.3 PRK14949 <11377..11776 CDD:237863
PRK08581 11922..>12215 CDD:236304
PRK14949 <13679..14114 CDD:237863
PRK14949 <14663..15055 CDD:237863
Rcd2NP_649244.3 VWC 114..168 CDD:214564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.