DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc14A and Kcp

DIOPT Version :9

Sequence 1:NP_727928.3 Gene:Muc14A / 318097 FlyBaseID:FBgn0052580 Length:16223 Species:Drosophila melanogaster
Sequence 2:XP_038964921.1 Gene:Kcp / 296952 RGDID:1561119 Length:1671 Species:Rattus norvegicus


Alignment Length:312 Identity:65/312 - (20%)
Similarity:97/312 - (31%) Gaps:82/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   745 EPVKTHDVCECTCLLEQGNDSC------------------TCNCMTDFISTSIQISSTGPDQISQ 791
            |||.:.|.|. :|....|:..|                  .|..:.|.....:|..:|....|..
  Rat   416 EPVGSQDPCS-SCHCANGSVQCEPLPCPPAPCRYPGRIPGQCCPVCDVPCPPVQAVNTRDMNIGA 479

  Fly   792 NKMGNQSQSVPLLNTEFSDLMKISTTYKMHQTQNDIEKLSKSPPVLS---TTSSGLPKWPTTRTL 853
            .:        ||.:...:...........:..:|   :.::||||.:   ..||..|.....|:|
  Rat   480 RR--------PLPSKRMAAAFGAPARLVKYPVRN---RTARSPPVSTLPPAPSSAQPVCSMVRSL 533

  Fly   854 EKKKQQSK-SLPSLSTISNFHFEKSNFHGCDCTC---QLELGRDSCICECNFKESTSDVSTSRSN 914
            .:....|: :.|.|...:.          .:|.|   ...|...:.|.......:..|...|..:
  Rat   534 LRGSSGSQMTSPVLPVPAK----------TECLCAGLHFALQYPANILPSRPVSAQPDPVFSGFD 588

  Fly   915 QPLPTKLHSVKDNAPHSLTNANP--ESLTSKDLT-TKGNGVTDNKITTLSKLSSDNVCECTCLLE 976
            ||..|.|       || |....|  ||.|...|. :.|...||          .|:.|: ||..|
  Rat   589 QPTLTSL-------PH-LGACCPSCESCTYHGLVYSNGQNFTD----------VDSPCQ-TCYCE 634

  Fly   977 QGNDSCT-CNCMTDT------------NSIDESILTASQIVSSEDLQYSSNP 1015
            .|...|: .||.:.|            ....:.||.|...|..|...:..:|
  Rat   635 DGTVRCSVINCPSLTCAKPQNGPGQCCPKCPDCILEAQMFVDGERFPHPRDP 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc14ANP_727928.3 PRK14949 <11377..11776 CDD:237863
PRK08581 11922..>12215 CDD:236304
PRK14949 <13679..14114 CDD:237863
PRK14949 <14663..15055 CDD:237863
KcpXP_038964921.1 VWC 227..281 CDD:278520
VWC 285..341 CDD:327433
VWC 405..460 CDD:327433 9/44 (20%)
VWC 608..664 CDD:327433 15/66 (23%)
VWC 725..781 CDD:327433
VWC 1022..1078 CDD:327433
VWC 1139..1204 CDD:327433
VWC <1223..1264 CDD:327433
VWC 1271..1328 CDD:327433
VWD 1335..1484 CDD:395046
C8 1527..1599 CDD:214843
TIL 1610..1663 CDD:410995
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1216
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.